PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.123440.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 186aa    MW: 20747.1 Da    PI: 10.4348
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.123440.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.86.1e-191358147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEd +l ++v+++G+++W++I+r++  gR++k+c++rw + 
   Cucsa.123440.1 13 KGPWSAEEDRILTRLVERYGPRNWSLISRYVK-GRSGKSCRLRWCNQ 58
                     79*****************************9.***********985 PP

2Myb_DNA-binding54.42.8e-1767109347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++++ Ed+ +v a+ ++G++ W+tIar ++ gRt++ +k++w++ 
   Cucsa.123440.1  67 PFSPAEDDAIVAAHSRYGNR-WATIARLLP-GRTDNAVKNHWNST 109
                      79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.411863IPR017930Myb domain
SuperFamilySSF466893.56E-3210106IPR009057Homeodomain-like
SMARTSM007173.5E-151261IPR001005SANT/Myb domain
PfamPF002494.1E-181358IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-231466IPR009057Homeodomain-like
CDDcd001672.38E-141557No hitNo description
SMARTSM007176.9E-1564112IPR001005SANT/Myb domain
PROSITE profilePS5129420.71965114IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.4E-2267113IPR009057Homeodomain-like
CDDcd001671.10E-1067110No hitNo description
PfamPF002493.9E-1467109IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 186 aa     Download sequence    Send to blast
PPPSSSPIPD KIKGPWSAEE DRILTRLVER YGPRNWSLIS RYVKGRSGKS CRLRWCNQLC  60
PGVEHRPFSP AEDDAIVAAH SRYGNRWATI ARLLPGRTDN AVKNHWNSTL KRRVRDDRRN  120
SSSNHTSDVV GGGGNVGGGG GEVVRESDRR SENLPAGFWE VMKDVVAREV REYMTTTFSE  180
NRGFG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-4281142108B-MYB
1h88_C1e-41911454159MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-41911454159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818610.0LN681861.1 Cucumis melo genomic scaffold, anchoredscaffold00029.
GenBankLN7132610.0LN713261.1 Cucumis melo genomic chromosome, chr_7.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008452503.11e-117PREDICTED: transcriptional activator Myb-like
SwissprotQ9FDW12e-53MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A0A0L4S71e-114A0A0A0L4S7_CUCSA; Uncharacterized protein
STRINGGLYMA06G04010.12e-79(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF50743256
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50060.12e-55myb domain protein 77